PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv6_154690_swdf.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family HD-ZIP
Protein Properties Length: 331aa    MW: 37588.4 Da    PI: 4.6958
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv6_154690_swdf.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.46e-1985138356
                         --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         k++++++eq+e Le+ Fe ++++  e++ +LA++lgL+ rqV +WFqNrRa++k
  Bv6_154690_swdf.t1  85 KKRRLKSEQVEYLEKSFEVENKLEPERKVQLAQQLGLQPRQVAIWFQNRRARYK 138
                         566899***********************************************9 PP

2HD-ZIP_I/II127.36.7e-4184175192
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         ekkrrl++eqv+ LE+sFe e+kLeperKv+la++Lglqprqva+WFqnrRAR+ktkq+Ek++++Lk++yd+lk + ++L++e+e+L++e+
  Bv6_154690_swdf.t1  84 EKKRRLKSEQVEYLEKSFEVENKLEPERKVQLAQQLGLQPRQVAIWFQNRRARYKTKQIEKEFDSLKASYDSLKIDYDSLNNEKENLKNEV 174
                         69**************************************************************************************998 PP

         HD-ZIP_I/II  92 k 92 
                         +
  Bv6_154690_swdf.t1 175 E 175
                         6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.88E-1975142IPR009057Homeodomain-like
PROSITE profilePS5007117.57280140IPR001356Homeobox domain
SMARTSM003893.5E-1883144IPR001356Homeobox domain
CDDcd000868.32E-1785141No hitNo description
PfamPF000463.0E-1685138IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.1E-1887147IPR009057Homeodomain-like
PRINTSPR000315.5E-6111120IPR000047Helix-turn-helix motif
PROSITE patternPS000270115138IPR017970Homeobox, conserved site
PRINTSPR000315.5E-6120136IPR000047Helix-turn-helix motif
PfamPF021835.1E-15140181IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MEGGNSFSGC HDMIALLENS NNSIWAPSSS SFPENMVNFD QEPQQGRRAS PKRGRRHGGP  60
FARASDGEDT GGEESDAYPN YHPEKKRRLK SEQVEYLEKS FEVENKLEPE RKVQLAQQLG  120
LQPRQVAIWF QNRRARYKTK QIEKEFDSLK ASYDSLKIDY DSLNNEKENL KNEVELLKKK  180
LTQKEGKEID SNPDNILHNV EGVIPNTETH EKVHKFGSGC VVMPSNKQVE DASSAKSDVL  240
DSESPHCADG NQTCALIEAS STLMRDSEQQ SDFSSEDEEH LMMSKSLLLP QTPPTFNNFL  300
KVADDENYDP NIANTCNFSL VDDQPFWSWL Y
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18489KKRRLK
2132140RRARYKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010683269.10.0PREDICTED: homeobox-leucine zipper protein HAT5-like isoform X1
TrEMBLA0A0J8EVD70.0A0A0J8EVD7_BETVU; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.13e-36homeobox 1